PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8985_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 993aa    MW: 109728 Da    PI: 6.6075
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8985_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.41.6e-41149226178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cqve+C adls+ak+yhrrhkvCe+hska+ +lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Neem_8985_f_1 149 VCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 226
                    6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-33142211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.385147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-39148229IPR004333Transcription factor, SBP-box
PfamPF031108.6E-30150223IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.203.4E-5737849IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.11E-6737849IPR020683Ankyrin repeat-containing domain
CDDcd002044.21E-6738849No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 993 aa     Download sequence    Send to blast
METRFIGEAH HIYGMNSMDL RAVGKRTLEW DLNDWKWDGD LFIASPLNPV PNDNIGQKFF  60
PLGTGNSSNS SSSCSEEVNL GIEKGKKELE KKRRAIVVED HNSYEAAAGG LTLKLGGNGY  120
PLTEREMGNW AGTSGKKTKF GGGSSRRAVC QVEDCGADLS NAKDYHRRHK VCEMHSKASR  180
ALVGNVMQRF CQQCSRFHVL QEFDEGKRSC RRRLAGHNKR RRKTNPDAVG NGSSLNDDQT  240
SGYLLISILR ILSNMHSNRS DQRTDQDLLS HLLRSLANPA GENGGRGISG LLQEPQDMLT  300
DRTSVGNSEV VSAMLANGQG TPGPFRQPLT AMVSEMPHQG SQSHTTRVAE VQNDEDIERL  360
PVPANPGTSS LDCPSWVQLD SQQSSPPQTS GNSDSASAQS PSSSSDAQSR TDRIVFKLFG  420
KEPNDFPLVL RAQILDWLSH SPTDMESYIR PGCVILTIYL RQAEAAWEEL CCDLTFSLSR  480
LLGLSDDSFW TNGWVYVRVQ HQIAFIYDGQ VVVDTSLPLR SNNHSKILSV KPIAVSASER  540
VQFLVKGNKL ARPATRLLCA VEGKYMVQEA TYEMDDVESF KDHDELHCVN FSCSIPVVTG  600
RGFIEIEDHG FGSSFFPFIV AEEDVCSEIR MLESALEFNG TDADVEQFGK TETKNQAMDF  660
IHEIGWLFHR SQLKSRLGHL DPNTDLFPLR RFKWLIEFSM DHEWCAVVKK LLNILLDGNV  720
GSGEHSSVDI ALSELGLLHR AVRKNCHPLV DLLLRFVPEK VSDRLEPGKE AQADGGHKGF  780
IFRPDVIGPA GLTPLHIAAG KDGSEDVLDA LTDDPGKVGI EAWKNAHDSS GSTPEDYARL  840
RGHYSYIHLV QRKINKRLAA GHVVVDIPGV IPDSNINQKQ SNELTASFEI GQTAVKPVQR  900
NCNLCHQKLA FRTASSGSLV YRPAMLSMVA IAAVCVCVAL LFKSCPEVLR PAMLSMVAIA  960
AVCVCVALLF KSCPEVLYVF RPFRWEMLDF GAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31143223484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444595.10.0hypothetical protein CICLE_v10018697mg
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A067H7A40.0A0A067H7A4_CITSI; Uncharacterized protein
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1